PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr009229.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 1041aa    MW: 114237 Da    PI: 5.2838
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr009229.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-183783148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde+l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
      Pbr009229.1 37 KGQWTPEEDEILRRAVQRFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 83
                     799****************************9.************986 PP

2Myb_DNA-binding64.42.2e-2089135148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEde ++++vk++G++ W+tIa++++ gR +kqc++rw+++l
      Pbr009229.1  89 KGPWSKEEDEVIIELVKKYGPKKWSTIAQHLP-GRIGKQCRERWHNHL 135
                      79******************************.*************97 PP

3Myb_DNA-binding50.16.5e-16141183145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++++G++ W+   + ++ gRt++++k++w+
      Pbr009229.1 141 KEAWTQEEELALIRAHQMYGNK-WAELTKFLP-GRTDNSIKNHWN 183
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.1773283IPR017930Myb domain
SMARTSM007171.2E-153685IPR001005SANT/Myb domain
PfamPF002492.8E-163783IPR001005SANT/Myb domain
SuperFamilySSF466896.46E-163893IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-223895IPR009057Homeodomain-like
CDDcd001672.12E-144083No hitNo description
PROSITE profilePS5129434.17184139IPR017930Myb domain
SuperFamilySSF466895.99E-3286182IPR009057Homeodomain-like
SMARTSM007173.2E-1988137IPR001005SANT/Myb domain
PfamPF002491.5E-1889135IPR001005SANT/Myb domain
CDDcd001674.91E-1791135No hitNo description
Gene3DG3DSA:1.10.10.601.6E-2796143IPR009057Homeodomain-like
SMARTSM007172.9E-15140188IPR001005SANT/Myb domain
PROSITE profilePS5129419.899140190IPR017930Myb domain
PfamPF002492.5E-14141184IPR001005SANT/Myb domain
CDDcd001679.25E-12143183No hitNo description
Gene3DG3DSA:1.10.10.607.0E-22144190IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1041 aa     Download sequence    Send to blast
MEGERTNSTP AEGLGDSIQK VRALHGRTSG PTRRSTKGQW TPEEDEILRR AVQRFKGKNW  60
KKIAECFKDR TDVQCLHRWQ KVLNPELVKG PWSKEEDEVI IELVKKYGPK KWSTIAQHLP  120
GRIGKQCRER WHNHLNPGIN KEAWTQEEEL ALIRAHQMYG NKWAELTKFL PGRTDNSIKN  180
HWNSSVKKKL DSYLKSGLLT QFQGMPHVGN QNQHMMSSSS RMQSSGDDSG AKGAEVEEIS  240
ECSQDSTVAG CYLSAPEMAN VVPHTREEFG NNDVSRLAND PSCSPASCSE PYYPSMTIGD  300
ANFSIPEIPP ELVCSKFLEQ NFSHDAGASM SGDFQLNLHE LPNISSLECG QESSRMYTHC  360
MRSNESHEGV EAPFQTSTSM GNMAFGSVKS EHMLISDDEC CRALFSMNGG CFPSRDFTNC  420
SNIVGLGACT DSVLLQPTNL QISETGRTSA SQSYHPLDSG VIGTSCSQVV SAHENPLIYA  480
GEPTHLFRVQ DQEFVTSLND GFIYNNESAS SPCKSDLVND SSKLVPVNTF ASGLDAQTCP  540
VDVSSNEQTE QQDAGKEPQD AGALCYEPPR FPSLDIPFFS CDLIQSCNDM QQEYSPLGIR  600
QLMMSSMNCL TPYRLWDSPS REGSPDALLK SAAKTFTGTP SILKKRHRDL LSPLSPLSDR  660
RIDKRLGTDV TSCLARDFSR LDVMFEDTEK KEDSPSPSSD QKRNSDASGE NKENKGTCEN  720
KVEKGIDGTE MSDDGTVQRD FDDGQSREKG KQFQQTADVD AKSKVDVVPT TQSAQPSGVL  780
VERNTNDLLL NSPDVVGCKA EKPFSSTART PKDQLRKSFE ATNPGVPSKS FSARQCSSVK  840
TPTICVKKHG ILADKCVQSD STSAPPETDS ASNDVNIESV FGGTPFKRSI DSPSAWKSPW  900
FINSFVPGPR VDTEITIEDI GFFMSPGDRS YDAIGLMKQI SEQTAAAYAN AQEVLGNETP  960
ESLFRERQKD RDIAGPENKQ GSPNQPGSSS LSASNVLVEC RTLDFSECGT PGKKGTENVK  1020
SSSNAKSFSS PTSYLLKGCR *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C1e-69371906159MYB PROTO-ONCOGENE PROTEIN
1h89_C1e-69371906159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009367916.10.0PREDICTED: myb-related protein 3R-1-like isoform X1
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLM5XM690.0M5XM69_PRUPE; Uncharacterized protein
STRINGPOPTR_0006s25840.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37273362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.10.0Homeodomain-like protein